Recombinant Human intestinal alkaline phosphatase protein (ab114266)

Overview

  • Product name
    Recombinant Human intestinal alkaline phosphatase protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVK ANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV
    • Molecular weight
      35 kDa including tags
    • Amino acids
      74 to 162

Specifications

Our Abpromise guarantee covers the use of ab114266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alkaline phosphatase intestinal
    • Alkaline phosphomonoesterase
    • Alpi
    • Glycerophosphatase
    • IAP
    • Intestinal alkaline phosphatase
    • Intestinal-type alkaline phosphatase
    • Kasahara isozyme
    • OTTHUMP00000164357
    • PPBI_HUMAN
    see all
  • Sequence similarities
    Belongs to the alkaline phosphatase family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human intestinal alkaline phosphatase protein images

  • ab114266 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human intestinal alkaline phosphatase protein (ab114266)

ab114266 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up