Recombinant Human intestinal alkaline phosphatase protein (ab114266)

Overview

  • Product nameRecombinant Human intestinal alkaline phosphatase protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09923
    • SpeciesHuman
    • SequenceLKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVK ANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV
    • Molecular weight35 kDa including tags
    • Amino acids74 to 162

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alkaline phosphatase intestinal
    • Alkaline phosphomonoesterase
    • Alpi
    • Glycerophosphatase
    • IAP
    • Intestinal alkaline phosphatase
    • Intestinal-type alkaline phosphatase
    • Kasahara isozyme
    • OTTHUMP00000164357
    • PPBI_HUMAN
    see all
  • Sequence similaritiesBelongs to the alkaline phosphatase family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human intestinal alkaline phosphatase protein images

  • ab114266 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human intestinal alkaline phosphatase protein (ab114266)

ab114266 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"