Recombinant Human intestinal FABP protein (ab115502)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTI TQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLI GKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
    • Molecular weight
      16 kDa including tags
    • Amino acids
      2 to 131
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    ab115502 is purified using Ni-NTA chromatography.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.40
    Constituents: 0.29% Sodium chloride, 0.69% Phosphate Buffer

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

General Info

  • Alternative names
    • FABP 2
    • FABP2
    • FABPI
    • FABPI_HUMAN
    • Fatty acid binding protein
    • Fatty acid binding protein 2 intestinal
    • Fatty acid binding protein intestinal
    • Fatty acid-binding protein
    • Fatty acid-binding protein 2
    • I FABP
    • I-FABP
    • IFABP
    • intestinal
    • Intestinal fatty acid binding protein 2
    • Intestinal-type fatty acid-binding protein
    • MGC133132
    • OTTHUMP00000163925
    see all
  • Function
    FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.
  • Tissue specificity
    Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum.
  • Sequence similarities
    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain
    Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human intestinal FABP protein images

  • 14% SDS-PAGE showing ab115502
    Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
    Lane 2: reduced and boiled sample, 5µg/lane.
    Lane 3: non-reduced and non-boiled sample, 5µg/lane.

References for Recombinant Human intestinal FABP protein (ab115502)

ab115502 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up