Recombinant Human Intra Acrosomal Protein (ab151826)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSS EHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSG EHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASG EQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKK IFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
    • Molecular weight
      27 kDa including tags
    • Amino acids
      22 to 265
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151826 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It was lyophilized from an 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Additional notes
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • Acrosomal protein SP 10
    • Acrosomal protein SP-10
    • Acrosomal vesicle protein 1
    • ACRV1
    • ASPX_HUMAN
    • D11S4365
    • Msa63
    • SP 10
    • Sp10
    • SPACA2
    • Sperm protein 10
    see all
  • Tissue specificity
    Testis.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle > acrosome. Nascent acrosomal vesicle of Golgi phase spermatids.
  • Information by UniProt

References

ab151826 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up