Recombinant Human Intra Acrosomal Protein (ab157837)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNRFLLLMSLYLLGPARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS DAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAA TEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGS GEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQG KCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTR MQIICCRNQSFCNKI
    • Amino acids
      1 to 265
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157837 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acrosomal protein SP 10
    • Acrosomal protein SP-10
    • Acrosomal vesicle protein 1
    • ACRV1
    • ASPX_HUMAN
    • D11S4365
    • Msa63
    • SP 10
    • Sp10
    • SPACA2
    • Sperm protein 10
    see all
  • Tissue specificity
    Testis.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle > acrosome. Nascent acrosomal vesicle of Golgi phase spermatids.
  • Information by UniProt

Images

  • ab157837 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157837 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157837.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up