Recombinant Human Intrinsic Factor protein (ab158518)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSS AYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALT SSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEAT LPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFG QVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTT DMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPS NPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEA QRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVA DYIPFNHEHITANFTQY
    • Amino acids
      1 to 417
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gastric Intrinsic Factor
    • Gastric intrinsic factor (vitamin B synthesis)
    • GIF
    • IF
    • IFMH
    • INF
    • Intrinsic factor
    • TCM3
    • TCN3
    see all
  • Relevance
    Intrinsic factor promotes absorption of the essential vitamin Cobalamin (Cbl) in the ileum by specific receptor mediated endocytosis. Defects in the gene GIF are the cause of hereditary intrinsic factor deficiency (IFD) also called congenital pernicious anemia. IFD is an autosomal recessive disorder characterized by megaloblastic anemia.
  • Cellular localization
    Secreted

Images

  • ab158518 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158518 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up