Overview

  • Product name
    Recombinant Human INTS3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELQKGKGAAAAAAASGAAGGGGGGAGAGAPGGGRLLLSTSLDAKDELEE RLERCMSIVTSMTAGVSEREANDALNAYVCKGLPQHEEICLGLFTLILTE PAQAQKCYRDLALVSRDGMNIVLNKINQILMEKYLKLQDTCRTQLVWLVR ELVKSGVLGADGVCMTFMKQIAGGDVTAKNIWLAESVLDILTEQREWVLK SSILIAMAVYTYLRLIVDHHGTAQLQALRQKEVDFCISLLRERFMECLMI GRDLVRLLQNVARIPEFELLWKDIIHNPQALSPQFTGILQLLQSRTSRKF LACRLTPDMETKLLFMTSRVRFGQQKRYQDWFQRQYLSTPDSQSLRCDLI RYICGVVHPSNEVLSSDILPRWAIIGWLLTTCTSNVAASNAKLALFYDWL FFSPDKDSIMNIEPAILVMHHSMKPHPAITATLLDFMCRIIPNFYPPLEG HVRQGVFSSLNHIVEKRVLAHLAPLFDNPKLDKELRAMLREKFPEFCSSP SPPVEVKIEEPVSMEMDNHMSDKDESCYDNAEAAFSDDEEDLNSKGKKRE FRFHPIKETVVEEPVDITPYLDQLDESLRDKVLQLQKGSDTEAQCEVMQE IVDQVLEEDFDSEQLSVLASCLQELFKAHFRGEVLPEEITEESLEESVGK PLYLIFRNLCQMQEDNSSFSLLLDLLSELYQKQPKIGYHLLYYLRASKAA AGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFP DETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSL DWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRRE KPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLLIKNNS LPRKRQSLRSSSSKLAQLTLEQILEHLDNLRLNLTNTKQNFFSQTPILQA LQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKN ATQPPNAEEESGSSSASEEEDTKPKPTKRKRKGSSAVGSDSD
    • Amino acids
      1 to 1042
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163923 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C1orf193
    • C1orf60
    • FLJ21919
    • INT 3
    • Int3
    • INT3_HUMAN
    • Integrator complex subunit 3
    • Ints3
    • Sensor of single-strand DNA complex subunit A
    • Sensor of ssDNA subunit A
    • SOSS complex subunit A
    • SOSS-A
    see all
  • Relevance
    Function: Component of the Integrator complex. The Integrator complex is involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes. Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. The SOSS complex is required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways. In the SOSS complex, it is required for the assembly of the complex and for stabilization of the complex at DNA damage sites. Similarity: Belongs to the Integrator subunit 3 family.
  • Cellular localization
    Nuclear

Images

  • ab163923 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163923 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163923.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up