Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EGSSLHSEPERAGLGPAPGTESPQAEFWTDGQTEPAAAGLGVETERPKQK TEPDRSSLRTHLEWSWSELETTCLWTETGTDGLWTDPHRSDLQFQPEEA
    • Amino acids
      63 to 161
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4
    • 5-trisphosphate 3-kinase C
    • Inositol 1
    • inositol 1,4,5 trisphosphate 3 kinase C
    • Inositol trisphosphate 3 kinase C
    • Inositol-trisphosphate 3-kinase C
    • InsP 3 kinase C
    • InsP 3-kinase C
    • IP3 3-kinase C
    • IP3 3KC
    • IP3K C
    • IP3KC
    • IP3KC_HUMAN
    • Itpkc
    see all
  • Function
    Can phosphorylate inositol 2,4,5-triphosphate to inositol 2,4,5,6-tetraphosphate.
  • Tissue specificity
    Highly expressed in pancreas, skeletal muscle, liver, placenta and weakly in kidney and brain.
  • Involvement in disease
    Defects in ITPKC are a cause of Kawasaki disease (KWD) [MIM:611775]; also known as mucocutaneous lymph node syndrome or infantile polyarteritis. Kawasaki disease is an acute, self-limited vasculitis of infants and children characterized by prolonged fever unresponsive to antibiotics, polymorphous skin rash, erythema of the oral mucosa, lips, and tongue, erythema of the palms and soles, bilateral conjunctival injection, and cervical lymphadenopathy. Coronary artery aneurysms develop in 15 to 25% of those left untreated, making Kawasaki disease the leading cause of acquired heart disease among children in developed countries.
  • Sequence similarities
    Belongs to the inositol phosphokinase (IPK) family.
  • Cellular localization
    Nucleus. Cytoplasm. Shuttles actively between nucleus and cytoplasm with both nuclear import and nuclear export activity.
  • Information by UniProt

Images

  • ab164241 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up