Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQ FYETLPAEMRKFTPQYKGVS
    • Amino acids
      1 to 70
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP 1D myo inositol hexakisphosphate phosphotransferase
    • IHPK 2
    • IHPK2
    • Inositol hexakisphosphate kinase 2
    • InsP6 kinase 2
    • Ip6k2
    • IP6K2_HUMAN
    • KIAA0263
    • OTTHUMP00000164824
    • P(i) uptake stimulator
    • P(i)-uptake stimulator
    • Pi uptake stimulator
    • PiUS
    see all
  • Function
    Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4.
  • Sequence similarities
    Belongs to the inositol phosphokinase (IPK) family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162557 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up