Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VQQYRVAMTAKDCSIMIALSPCLQDASSDQRPVVPSSRSRFAFSVSVLDL DLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKESEDCTLVLHK V
    • Amino acids
      391 to 491
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3
    • 4
    • 5
    • 6)P5 2-kinase
    • 6-pentakisphosphate 2-kinase
    • bA476B13.1
    • bA476B13.1 (novel protein)
    • C9orf12
    • inositol 1,3,4,5,6 pentakisphosphate 2 kinase
    • Inositol pentakisphosphate 2 kinase
    • Inositol-1
    • Inositol-pentakisphosphate 2-kinase
    • Ins
    • Ins(1
    • Ins(1,3,4,5,6)P5 2 kinase
    • InsP5 2 kinase
    • InsP5 2-kinase
    • INSP5K2
    • IP5K
    • IPK1
    • IPK1 homolog
    • IPPK
    • IPPK_HUMAN
    see all
  • Function
    Phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, non-homologous end-joining, endocytosis, ion channel regulation. It also protects cells from TNF-alpha-induced apoptosis.
  • Tissue specificity
    Ubiquitously expressed, with high expression in heart, brain, testis and placenta.
  • Sequence similarities
    Belongs to the IPK1 type 2 family.
  • Domain
    The EXKPK motif is conserved in inositol-pentakisphosphate 2-kinases of both family 1 and 2.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab163875 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up