Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ96C06
    • SpeciesHuman
    • SequenceMAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIV RDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIIT AWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGS QTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPSPFCW PLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWT AVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDE RLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGR LAVDTDTFSFGVVVLETLAGQRAVKTHGARTKYLVYERLEKLQAVVAGVP GHLEAASCIPPSPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQ RGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGES SWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDG ALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS
    • Molecular weight96 kDa including tags
    • Amino acids1 to 633

Specifications

Our Abpromise guarantee covers the use of ab114271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Il1rak
    • Interleukin 1 receptor associated kinase 1
    • Interleukin-1 receptor-associated kinase 1
    • IRAK
    • IRAK-1
    • Irak1
    • IRAK1_HUMAN
    • mPLK
    • OTTHUMP00000026014
    • OTTHUMP00000026015
    • OTTHUMP00000026020
    • OTTHUMP00000180621
    • Pelle
    • Pelle homolog
    • Pelle-like protein kinase
    • Plpk
    see all
  • FunctionBinds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization. Isoform 1 binds rapidly but is then degraded allowing isoform 2 to mediate a slower, more sustained response to the cytokine. Isoform 2 is inactive suggesting that the kinase activity of this enzyme is not required for IL-1 signaling. Once phosphorylated, IRAK1 recruits the adapter protein PELI1.
  • Tissue specificityIsoform 1 and isoform 2 are ubiquitously expressed in all tissues examined, with isoform 1 being more strongly expressed than isoform 2.
  • Sequence similaritiesBelongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated or is transphosphorylated by IRAK4 following recruitment to the IL-1RI. In the case of isoform 1, this is linked to ubiquitination and degradation.
    Polyubiquitinated; after cell stimulation with IL-1-beta. Polyubiquitination occurs with polyubiquitin chains linked through 'Lys-63'.
  • Information by UniProt

Recombinant Human IRAK protein images

  • 12.5% SDS-PAGE analysis of ab114271 stained with Coomassie Blue.

References for Recombinant Human IRAK protein (ab114271)

ab114271 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114271.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"