Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIV RDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIIT AWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGS QTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPSPFCW PLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWT AVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDE RLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGR LAVDTDTFSFGVVVLETLAGQRAVKTHGARTKYLVYERLEKLQAVVAGVP GHLEAASCIPPSPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQ RGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGES SWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDG ALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS
    • Molecular weight
      96 kDa including tags
    • Amino acids
      1 to 633

Specifications

Our Abpromise guarantee covers the use of ab114271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AA48924
    • Il1rak
    • Interleukin 1 receptor associated kinase 1
    • Interleukin-1 receptor-associated kinase 1
    • IRAK
    • IRAK-1
    • Irak1
    • IRAK1-S
    • IRAK1_HUMAN
    • mPLK
    • OTTHUMP00000026014
    • OTTHUMP00000026015
    • OTTHUMP00000026020
    • OTTHUMP00000180621
    • Pelle
    • Pelle homolog
    • Pelle-like protein kinase
    • Plpk
    see all
  • Function
    Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization. Isoform 1 binds rapidly but is then degraded allowing isoform 2 to mediate a slower, more sustained response to the cytokine. Isoform 2 is inactive suggesting that the kinase activity of this enzyme is not required for IL-1 signaling. Once phosphorylated, IRAK1 recruits the adapter protein PELI1.
  • Tissue specificity
    Isoform 1 and isoform 2 are ubiquitously expressed in all tissues examined, with isoform 1 being more strongly expressed than isoform 2.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated or is transphosphorylated by IRAK4 following recruitment to the IL-1RI. In the case of isoform 1, this is linked to ubiquitination and degradation.
    Polyubiquitinated; after cell stimulation with IL-1-beta. Polyubiquitination occurs with polyubiquitin chains linked through 'Lys-63'.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab114271 stained with Coomassie Blue.

References

ab114271 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114271.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up