Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPK YIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE
    • Amino acids
      497 to 596
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ASRT5
    • IL 1 receptor associated kinase M
    • IL-1 receptor-associated kinase M
    • IL1 receptor associated kinase M
    • Interleukin 1 receptor associated kinase 3
    • Interleukin 1 receptor associated kinase M
    • Interleukin-1 receptor-associated kinase 3
    • IRAK M
    • IRAK-3
    • IRAK-M
    • Irak3
    • IRAK3_HUMAN
    see all
  • Function
    Inhibits dissociation of IRAK1 and IRAK4 from the Toll-like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex.
  • Tissue specificity
    Expressed predominantly in peripheral blood lymphocytes.
  • Involvement in disease
    Defects in IRAK3 are associated with susceptibility to asthma-related traits type 5 (ASRT5) [MIM:611064]. Asthma-related traits include clinical symptoms of asthma, such as coughing, wheezing, dyspnea, bronchial hyperresponsiveness as assessed by methacholine challenge test, serum IgE levels, atopy, and atopic dermatitis.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily.
    Contains 1 death domain.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab153170 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153170 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up