Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EEVINLVDQTSENAPTTVSRDVEEKPAHAPARPEAPVDSMLKDMATIILS TFLLIGWVAFIITYPLSMHQQQQLQHQQFQKELEKIQLLQQQQQQLPFHP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      401 to 500

Specifications

Our Abpromise guarantee covers the use of ab114174 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Endoplasmic reticulum (ER) to nucleus signalling 1
    • Endoplasmic reticulum to nucleus signaling 1
    • Endoplasmic reticulum-to-nucleus signaling 1
    • Endoribonuclease
    • ER to nucleus signaling 1
    • ERN 1
    • Ern1
    • ERN1_HUMAN
    • hIRE 1p
    • hIRE1p
    • Inositol requiring 1
    • Inositol requiring 1, S. cerevisiae, homolog of
    • Inositol requiring enzyme 1, S. cerevisiae, homolog of
    • Inositol requiring protein 1
    • inositol-requiring enzyme 1
    • Inositol-requiring protein 1
    • IRE 1
    • IRE 1a
    • IRE 1P
    • Ire1 alpha
    • Ire1-alpha
    • IRE1a
    • Ire1alpha
    • IRE1P
    • MGC163277
    • MGC163279
    • Protein kinase/endoribonuclease
    • RGD1559716
    • Serine/threonine protein kinase/endoribonuclease IRE1
    see all
  • Function
    Senses unfolded proteins in the lumen of the endoplasmic reticulum via its N-terminal domain which leads to enzyme auto-activation. The active endoribonuclease domain splices XBP1 mRNA to generate a new C-terminus, converting it into a potent unfolded-protein response transcriptional activator and triggering growth arrest and apoptosis.
  • Tissue specificity
    Ubiquitously expressed. High levels observed in pancreatic tissue.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 KEN domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab114174 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114174 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114174.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up