Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO75460
    • SpeciesHuman
    • SequenceEEVINLVDQTSENAPTTVSRDVEEKPAHAPARPEAPVDSMLKDMATIILS TFLLIGWVAFIITYPLSMHQQQQLQHQQFQKELEKIQLLQQQQQQLPFHP
    • Molecular weight37 kDa including tags
    • Amino acids401 to 500

Specifications

Our Abpromise guarantee covers the use of ab114174 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Endoplasmic reticulum (ER) to nucleus signalling 1
    • Endoplasmic reticulum to nucleus signaling 1
    • Endoplasmic reticulum-to-nucleus signaling 1
    • Endoribonuclease
    • ER to nucleus signaling 1
    • ERN 1
    • Ern1
    • ERN1_HUMAN
    • hIRE 1p
    • hIRE1p
    • Inositol requiring 1
    • Inositol requiring 1, S. cerevisiae, homolog of
    • Inositol requiring enzyme 1, S. cerevisiae, homolog of
    • Inositol requiring protein 1
    • inositol-requiring enzyme 1
    • Inositol-requiring protein 1
    • IRE 1
    • IRE 1a
    • IRE 1P
    • Ire1 alpha
    • Ire1-alpha
    • IRE1a
    • Ire1alpha
    • IRE1P
    • MGC163277
    • MGC163279
    • Protein kinase/endoribonuclease
    • RGD1559716
    • Serine/threonine protein kinase/endoribonuclease IRE1
    see all
  • FunctionSenses unfolded proteins in the lumen of the endoplasmic reticulum via its N-terminal domain which leads to enzyme auto-activation. The active endoribonuclease domain splices XBP1 mRNA to generate a new C-terminus, converting it into a potent unfolded-protein response transcriptional activator and triggering growth arrest and apoptosis.
  • Tissue specificityUbiquitously expressed. High levels observed in pancreatic tissue.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 KEN domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human IRE1 protein images

  • ab114174 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human IRE1 protein (ab114174)

ab114174 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114174.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"