Overview

  • Product name
    Recombinant Human IRX1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRI LAALPS
    • Amino acids
      424 to 479
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homeodomain protein IRXA1
    • Iroquois Homeobox Protein 1
    • Iroquois-class homeodomain protein IRX-1
    • IRX-5
    • IRXA1
    see all
  • Relevance
    IRX1 is a member of the Iroquois homeobox gene family. The genes from this family have multiple roles in vertebrate development. The gene encoding IRX1 is expressed in the brain, lung and gut during specific stages of mouse development.
  • Cellular localization
    Nuclear

Images

  • ab164007 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up