Recombinant human Isocitrate dehydrogenase protein (ab113858)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO75874
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSKKISGGSVVEMQGDEMTRIIWELIKEKL IFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDE KRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIII GRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEI YDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDS VAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPI ASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACI KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
    • Molecular weight49 kDa including tags
    • Amino acids1 to 414
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity: > 0.7 units/ml. One unit will convert 1.0 umole of isocitrate to alpha-ketoglutarate per minute at pH7.5 at 25C.
  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113858 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Cytosolic NADP isocitrate dehydrogenase
    • Cytosolic NADP-isocitrate dehydrogenase
    • Epididymis luminal protein 216
    • Epididymis secretory protein Li 26
    • HEL-216
    • HEL-S-26
    • ICDH
    • IDCD
    • IDH
    • IDH1
    • IDHC_HUMAN
    • IDP
    • IDPC
    • Isocitrate dehydrogenase [NADP] cytoplasmic
    • Isocitrate dehydrogenase 1 (NADP+) soluble
    • NADP dependent isocitrate dehydrogenase cytosolic
    • NADP dependent isocitrate dehydrogenase peroxisomal
    • NADP(+)-specific ICDH
    • Oxalosuccinate decarboxylase
    • PICD
    see all
  • Involvement in diseaseGlioma
    Genetic variations are associated with cartilaginous tumors such as enchondroma or chondrosarcoma. Mutations of Arg-132 to Cys, Gly or His abolish the conversion of isocitrate to alpha-ketoglutarate. Instead, alpha-ketoglutarate is converted to R(-)-2-hydroxyglutarate.
  • Sequence similaritiesBelongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Post-translational
    modifications
    Acetylation at Lys-374 dramatically reduces catalytic activity.
  • Cellular localizationCytoplasm. Peroxisome.
  • Information by UniProt

Recombinant human Isocitrate dehydrogenase protein images

  • 15% SDS-PAGE analysis of 3 µg ab113858.

References for Recombinant human Isocitrate dehydrogenase protein (ab113858)

ab113858 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your reply.

I was in touch with the supplying lab and they weren't sure why the higher band was being detected.They verified this protein with 15% SDS-PAGE and hadn't identified anyimpurities above 70kDa.
They wondered ifth...

Read More

Thank you for your inquiry. I am sorry to hear about the purity problem with ab113858.

Do you think you could resend the gel image? Unfortunately it didn't go through. Usually .jpg, .ppt, .doc, or .pdf transfer well.

Can you tell me...

Read More

Thank you for contacting Abcam.

The bioactivity has just been tested and the information os below:

Specific activity: > 0.7 units/ml. One unit will convert 1.0 umole of isocitrate to alpha-ketoglutarate per minute at pH7.5 at 25C...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"