Recombinant Human Isoleucyl tRNA synthetase protein (ab152465)

Overview

  • Product name
    Recombinant Human Isoleucyl tRNA synthetase protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLR SRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1172 to 1262

Specifications

Our Abpromise guarantee covers the use of ab152465 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ20736
    • IARS
    • IARS1
    • IleRS
    • ILRS
    • IRS
    • Isoleucine tRNA ligase
    • Isoleucine tRNA ligase 1 cytoplasmic
    • Isoleucine tRNA synthetase
    • Isoleucyl tRNA synthetase
    • PRO0785
    see all
  • Relevance
    Isoleucyl tRNA synthetase is a component of multi ARS complex and catalyzes the ligation of isoleucine with isoleucyl tRNA.
  • Cellular localization
    Cytoplasmic

Images

  • 12.5% SDS-PAGE analysis of ab152465 stained with Coomassie Blue.

References

ab152465 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152465.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up