Recombinant Human ISYNA1 protein (ab162569)

Overview

  • Product name
    Recombinant Human ISYNA1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SYNHLGNNDGENLSAPLQFRSKEVSKSNVVDDMVQSNPVLYTPGEEPDHC VVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDSLLAAPIMLDL
    • Amino acids
      331 to 430
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162569 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hINO1
    • hIPS
    • INO1
    • INO1_HUMAN
    • INOS
    • Inositol 3 phosphate synthase 1
    • Inositol-3-phosphate synthase 1
    • IPS
    • IPS 1
    • ISYNA 1
    • Isyna1
    • MI 1 P synthase
    • MI-1-P synthase
    • MI1P synthase
    • MIP synthase
    • Myo inositol 1 phosphate synthase A1
    • Myo-inositol 1-phosphate synthase A1
    • Myo-inositol-1-phosphate synthase
    see all
  • Function
    Key enzyme in myo-inositol biosynthesis pathway that catalyzes the conversion of glucose 6-phosphate to 1-myo-inositol 1-phosphate in a NAD-dependent manner. Rate-limiting enzyme in the synthesis of all inositol-containing compounds.
  • Tissue specificity
    Highly expressed in testis, ovary, heart, placenta and pancreas. Weakly expressed in blood leukocyte, thymus, skeletal muscle and colon.
  • Pathway
    Polyol metabolism; myo-inositol biosynthesis; myo-inositol from D-glucose 6-phosphate: step 1/2.
  • Sequence similarities
    Belongs to the myo-inositol-1-phosphate synthase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab162569 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162569 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162569.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up