Recombinant Human ITGB1BP1 protein (ab160409)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGV GKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP
    • Amino acids
      101 to 200
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bodenin
    • DKFZp686K08158
    • ICAP 1
    • ICAP 1A
    • ICAP 1alpha
    • ICAP 1B
    • ICAP-1
    • ICAP-1A
    • ICAP-1alpha
    • ICAP-1B
    • ICAP1
    • ICAP1A
    • ICAP1B
    • Integrin beta 1 binding protein 1
    • Integrin beta-1-binding protein 1
    • Integrin cytoplasmic domain associated protein 1
    • Integrin cytoplasmic domain associated protein 1 alpha
    • Integrin cytoplasmic domain associated protein 1 beta
    • Integrin cytoplasmic domain-associated protein 1
    • ITBP1_HUMAN
    • ITGB1BP1
    see all
  • Function
    May play a role in the recruitment of beta-1 integrins to the focal contacts during integrin-dependent cell adhesion. Isoform 2 does not bind the integrin cytoplasmic domain-associated protein-1.
  • Tissue specificity
    Expressed in intestine, colon, testis, ovary, thymus, spleen and prostate.
  • Sequence similarities
    Contains 1 PID domain.
  • Post-translational
    modifications
    Isoform 1 appears to be phosphorylated. The degree of phosphorylation is regulated by integrin-dependent cell-matrix interaction.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab160409 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160409 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160409.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up