Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP18564
    • SpeciesHuman
    • SequenceMGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCAQENFT HPSGVGERCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSD IVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLN TIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSI PYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAA VCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATV GLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLF QHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSP ECNCDCQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCECGEDMLSTD SCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCVRHKGL LCGGNGDCDCGECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCG KCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCK LAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEK DCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERS KAKWQTGTNPLYRGSTSTFKNVTYKHREKQKVDLSTDC
    • Molecular weight113 kDa including tags
    • Amino acids1 to 788

Specifications

Our Abpromise guarantee covers the use of ab116827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Integrin beta-6
    • ITB6_HUMAN
    • ITGB6
  • FunctionIntegrin alpha-V/beta-6 is a receptor for fibronectin and cytotactin. It recognizes the sequence R-G-D in its ligands. Internalisation of integrin alpha-V/beta-6 via clathrin-mediated endocytosis promotes carcinoma cell invasion.
  • Sequence similaritiesBelongs to the integrin beta chain family.
    Contains 1 VWFA domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human ITGB6 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116827 at approximately 112.75 kDa.

References for Recombinant Human ITGB6 protein (ab116827)

ab116827 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"