Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LPEGVANGIEVYSTKINSKVTSRFAHNVVTMRAVNRADTAKEVSFDVELP KTAFITNFTLTIDGVTYPGNVKEKEVAKKQYEKAVSQGKTAGLVKASGRK LEKFTVSVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVKHFEI EVDIFEPQGISMLDAEASFITNDLLGSALTKSFSGKKGHVSFKPSLDQQR SCPTCTDSLLNGDFTITYDVNRESPGNVQIVNGYFVHFFAPQGLPVVPKN VAFVIDISGSMAGRKLEQTKEALLRILEDMQEEDYLNFILFSGDVSTWKE HLVQATPENLQEARTFVKSMEDKGMTNINDGLLRGISMLNKAREEHRIPE RSTSIVIMLTDGDANVGESRPEKIQENVRNAIGGKFPLYNLGFGNNLNYN FLENMALENHGFARRIYEDSDADLQLQGFYEEVANPLLTGVEMEYPENAI LDLTQNTYQHFYDGSEIVVAGRLVDEDMNSFKADVKGHGATNDLTFTEEV DMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTAR ALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSY LTSYQPPQNPYYYVDGDVDHHHHHH
    • Molecular weight
      70 kDa including tags
    • Amino acids
      35 to 651
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is for the mature full length protein from aa 35 to 651. The signal and propeptide peptides are not included.

Specifications

Our Abpromise guarantee covers the use of ab194042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    The purity of ab194042 was determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names
    • AW108094
    • H3P
    • Inter alpha (globulin) inhibitor, H3 polypeptide
    • Inter alpha inhibitor heavy chain 3
    • Inter alpha trypsin inhibitor heavy chain H3
    • Intin3
    • ITI HC3
    • ITI heavy chain H3
    • PAIHC3
    • Pre alpha-inhibitor, heavy chain 3
    • Serum derived hyaluronan-associated protein
    • SHAP
    see all
  • Relevance
    The inter-alpha-trypsin inhibitors (ITI) are a family of structurally related plasma serine protease inhibitors involved in extracellular matrix stabilization and in prevention of tumor metastasis. ITIH3 may act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.
  • Cellular localization
    Secreted

References

ab194042 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up