Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPS AFDG LYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGD RWSSQQGSKA VYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKD LGIWHVPNKSPMQHWR NSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKY GEGKCWTDNGPVIPVVYDFGDA QKTASYYSPYGQREFTAGFVQFRVFN NERAANALCAGMRVTGCNTEHHCIGGGG YFPEASPQQCGDFSGFDWSG YGTHVGYSSSREITEAAVLLFYR

Specifications

Our Abpromise guarantee covers the use of ab89011 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab89011 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Endothelial lectin HL 1
    • Endothelial lectin HL-1
    • FLJ20022
    • Galactofuranose binding lectin
    • Galactofuranose-binding lectin
    • hIntL
    • HL 1
    • HL1
    • Intelectin
    • Intelectin 1
    • Intelectin-1
    • Intestinal lactoferrin receptor
    • INTL
    • ITLN
    • ITLN-1
    • ITLN1
    • ITLN1_HUMAN
    • LFR
    • Omentin
    • OTTHUMP00000027882
    see all
  • FunctionHas no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. Increases AKT phosphorylation in the absence and presence of insulin. May play a role in the defense system against microorganisms. May specifically recognize carbohydrate chains of pathogens and bacterial components containing galactofuranosyl residues, in a calcium-dependent manner. May be involved in iron metabolism.
  • Tissue specificityHighly expressed in omental adipose tissue where it is found in stromal vascular cells but not in fat cells but is barely detectable in subcutaneous adipose tissue (at protein level). Highly expressed in the small intestine. Also found in the heart, testis, colon, salivary gland, skeletal muscle, pancreas and thyroid and, to a lesser degree, in the uterus, spleen, prostate, lymph node and thymus.
  • Sequence similaritiesContains 1 fibrinogen C-terminal domain.
  • Developmental stageFound in fetal small intestine and thymus.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localizationCell membrane. Secreted. Enriched in lipid rafts.
  • Information by UniProt

References for Recombinant Human ITLN1 protein (ab89011)

ab89011 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab89011.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"