Recombinant Human Jagged 2 protein (ab114541)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9Y219
    • SpeciesHuman
    • SequenceAGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAG MINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKF
    • Molecular weight36 kDa including tags
    • Amino acids121 to 210

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D12Ggc2e
    • HJ 2
    • HJ2
    • JAG 2
    • JAG2
    • Jagged 2 precursor
    • Jagged2
    • Protein jagged 2
    • SER2
    • Syndactylism
    see all
  • RelevanceJagged 2 is a Notch ligand involved in the mediation of Notch signaling. Jagged 2 is expressed in heart, placenta and skeletal muscle and to a lesser extend in pancreas. Very low expression in brain, lung, liver and kidney. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. Jagged 2 is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for Jagged 2.
  • Cellular localizationCell Membrane

Recombinant Human Jagged 2 protein images

  • ab114541 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Jagged 2 protein (ab114541)

ab114541 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"