Recombinant Human JMJD7-PLA2G4B protein (ab160140)

Overview

  • Product name
    Recombinant Human JMJD7-PLA2G4B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNR PCIIRNALQHWPALQKWSLPYFRATVGSTEVSVAVTPDGYADAVRGDRFM MPAERRLPLSFVLDVLEGRAQHPGVLYVQKQCSNLPSELPQLLPDLESHV PWASEALGKMPDAVNFWLGEAAAVTSLHKDHYENLYCVVSGEKHFLFHPP SDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKVPWIPLDPLAPDLARY PSYSQAQALRCTVRAGEMLYLPALWFHHVQQSQGCIAVNFWYDMEYDLKY SYFQLLDSLTKASGLD
    • Amino acids
      1 to 316
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cPLA2-beta
    • Cytosolic phospholipase A2 beta
    • HsT16992
    • JMJD7-PLA2G4B protein
    • Jumonji domain containing 7 phospholipase A2, group IVB (cytosolic) read-through
    • OTTHUMP00000041703
    • OTTHUMP00000201605
    • PA24B_HUMAN
    • Phospholipase A2 group IVB
    • PHOSPHOLIPASE A2, CYTOSOLIC, CALCIUM-DEPENDENT, BETA
    • PLA2G4B
    see all
  • Function
    Calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position with a preference for arachidonoyl phospholipids. Has a much weaker activity than PLA2G4A. Isoform 3 has calcium-dependent activity against palmitoyl-arachidonyl-phosphatidylethanolamine and low level lysophospholipase activity but no activity against phosphatidylcholine.
  • Tissue specificity
    Widely expressed. Expressed at higher level in brain, heart, liver, cerebellum and pancreas. Isoform 3 is widely expressed.
  • Sequence similarities
    Contains 1 C2 domain.
    Contains 1 PLA2c domain.
  • Domain
    The N-terminal C2 domain associates with lipid membranes upon calcium binding. It modulates enzyme activity by presenting the active site to its substrate in response to elevations of cytosolic Ca(2+).
  • Cellular localization
    Cytoplasm > cytosol and Mitochondrion membrane. Early endosome membrane. Translocates to membrane vesicles in a calcium-dependent fashion.
  • Information by UniProt

Images

  • ab160140 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up