Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSEAPVQEEKLSASTSNLPCWLVEEFVVA EECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL
    • Molecular weight
      11 kDa including tags
    • Amino acids
      31 to 105
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_006685

Specifications

Our Abpromise guarantee covers the use of ab183230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab183230 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 0.02% DTT, 10% Glycerol

General Info

  • Alternative names
    • hJT
    • HJTB
    • HSPC222
    • JTB
    • JTB_HUMAN
    • Jumping translocation breakpoint
    • Jumping translocation breakpoint protein
    • OTTHUMP00000034759
    • PAR
    • PAR protein
    • Prostate androgen regulated protein
    • Prostate androgen-regulated protein
    • Protein JTB
    see all
  • Function
    Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Increases AURKB activity. Inhibits apoptosis induced by TGFB1 (By similarity). Overexpression induces swelling of mitochondria and reduces mitochondrial membrane potential.
  • Tissue specificity
    Ubiquitous. Expressed in all normal human tissues studied but overexpressed or underexpressed in many of their malignant counterparts.
  • Sequence similarities
    Belongs to the JTB family.
  • Cellular localization
    Membrane. Mitochondrion. Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle. Detected at the centrosome and along spindle fibers during prophase and metaphase. Detected at the midbody during telophase.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab183230 (3µg).

References

ab183230 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183230.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up