Overview

  • Product name
    Recombinant Human K0776 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADAWEEIRRLAADFQRAQFAEATQRLSERNCIEIVNKLIAQKQLEVVHT LDGKEYITPAQISKEMRDELHVRGGRVNIVDLQQVINVDLIHIENRIGDI IKSEKHVQLVLGQLIDENYLDRLAEEVNDKLQESGQVTISELCKTYDLPG NFLTQALTQRLGRIISGHIDLDNRGVIFTEAFVARHKARIRGLFSAITRP TAVNSLISKYGFQEQLLYSVLEELVNSGRLRGTVVGGRQDKAVFVPDIYS RTQSTWVDSFFRQNGYLEFDALSRLGIPDAVSYIKKRYKTTQLLFLKAAC VGQGLVDQVEASVEEAISSGTWVDIAPLLPTSLSVEDAAILLQQVMRAFS KQASTVVFSDTVVVSEKFINDCTELFRELMHQKAEKEMKNNPVHLITEED LKQISTLESVSTSKKDKKDERRRKATEGSGSMRGGGGGNAREYKIKKVKK KGRKDDDSDDESQSSHTGKKKPEISFMFQDEIEDFLRKHIQDAPEEFISE LAEYLIKQV
    • Amino acids
      1 to 509
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 UFM1-protein ligase 1
    • KIAA0776
    • LZAP-binding protein
    • Maxer
    • NLBP
    • RCAD
    • UFL1
    • UFL1_HUMAN
    • UFM1 specific ligase 1
    see all
  • Function
    E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown. May act as a tumor suppressor by inhibiting cell invasion, blocking NF-kappa-B signaling and increasing stability of CDK5RAP3.
  • Tissue specificity
    Ubiquitously expressed, with a high expression in liver (at protein level). Low expression in several invasive hepatocellular carcinomas, such HepG2, Hep3B, HLE and PLC.
  • Sequence similarities
    Belongs to the UFL1 family.
  • Post-translational
    modifications
    Ubiquitinated, leading to its degradation by the proteasome. Interaction with CDK5RAP3 protects each other against ubiquitination and degradation via the proteasome.
  • Cellular localization
    Endoplasmic reticulum. Cytoplasm. In cytoplasm colocalizes with CDK5RAP3.
  • Information by UniProt

Images

  • ab161615 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up