Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16099
    • SpeciesHuman
    • SequenceSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFE LLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK VAPEEFVKFQ
    • Molecular weight38 kDa
    • Amino acids21 to 130

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114499 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EAA 1
    • EAA1
    • Excitatory amino acid receptor 1
    • GluK4
    • Glutamate receptor
    • Glutamate receptor ionotropic kainate 4
    • Glutamate receptor ionotropic kainate 4 precursor
    • Glutamate receptor KA 1
    • Glutamate receptor KA 1precursor
    • Glutamate receptor KA-1
    • Glutamate receptor KA1
    • Glutamate receptor, ionotropic kainate 4
    • GRIK
    • GRIK 4
    • Grik4
    • GRIK4_HUMAN
    • ionotropic kainate 4
    • KA 1
    • KA1
    • OTTHUMP00000045951
    • OTTHUMP00000231881
    see all
  • FunctionReceptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists.
  • Sequence similaritiesBelongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK4 subfamily.
  • Cellular localizationCell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

Recombinant Human KA1 protein images

  • ab114499 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue

References for Recombinant Human KA1 protein (ab114499)

ab114499 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114499.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"