Overview

  • Product name
    Recombinant Human KAAG1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDDDAAPRVEGVPVAVHKHALHDGLRQVAG PGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQ VKEK
    • Molecular weight
      11 kDa including tags
    • Amino acids
      1 to 84
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105595 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab105595 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • KAAG1
    • KAAG1_HUMAN
    • Kidney associated antigen 1
    • Kidney-associated antigen 1
    • MGC78738
    • RU2 antisense gene protein
    • RU2AS
    see all
  • Tissue specificity
    Expressed in testis and kidney, and, at lower levels, in urinary bladder and liver. Expressed by a high proportion of tumors of various histologic origin, including melanomas, sarcomas and colorectal carcinomas.
  • Information by UniProt

Recombinant Human KAAG1 protein images

  • 15% SDS-PAGE analysis of 3µg ab105595.

References for Recombinant Human KAAG1 protein (ab105595)

ab105595 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105595.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up