Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNIL SASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDE LIKSGQLLGVKFIAELGVPLSQVKSISGTAQDGNTEPLPPDSGDKNLVIQ KSKDEAQDNGATIMPIITESFSLSAEDYEMKKIIVTDSDDDDDDDVIFCS EILPTKETLPSNNTVAQVQSNPGPVAISDVAPSASNNSPPLTNITPTQKL PTPVNQATLSQTQGSEKLLVSSAPTHLTPNIILLNQTPLSTPPNVSSSLP NHMPSSINLLVQNQQTPNSAILTGNKANEEEEEEIIDDDDDTISSSPDSA VSNTSLVPQADTSQNTSFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNT NDPGVGSKHLMEGQKIITLDTATEIEGLSTGCKVYANIGEDTYDIVIPVK DDPDEGEARLENEIPKTSGSEMANKRMKVKHDDHYELIVDGRVYYICIVC KRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERR YQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAY LSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQEN DSIFKQNVTDGSTEFEFIIPESY
    • Amino acids
      1 to 673
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160762 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Kaiso
    • Kaiso protein
    • Kaiso transcription factor
    • KAISO_HUMAN
    • Transcriptional regulator Kaiso
    • ZBTB 33
    • Zbtb33
    • Zinc finger and BTB domain containing 33
    • Zinc finger and BTB domain-containing protein 33
    • Zinc finger transcription factor Kaiso
    • ZNF 348
    • ZNF Kaiso
    • ZNF348
    see all
  • Function
    Transcriptional regulator with bimodal DNA-binding specificity. Binds to methylated CpG dinucleotides in the consensus sequence 5'-CGCG-3' and also binds to the non-methylated consensus sequence 5'-CTGCNA-3'. Recruits the N-CoR repressor complex to promote histone deacetylation and the formation of repressive chromatin structures in target gene promoters. May contribute to the repression of target genes of the Wnt signaling pathway. May also activate transcription of a subset of target genes by the recruitment of CTNND2.
  • Tissue specificity
    Expressed in vascular endothelium.
  • Sequence similarities
    Contains 1 BTB (POZ) domain.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus. Cytoplasm. Also cytoplasmic in cells grown at high densities.
  • Information by UniProt

Images

  • ab160762 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160762 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160762.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up