Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQVTWAEVTTESR QNSLPNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQVLTPGGEGPATI KTFRTPELPP
    • Molecular weight
      38 kDa including tags
    • Amino acids
      548 to 657

Specifications

Our Abpromise guarantee covers the use of ab116854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adhesion molecule-like X-linked
    • ADMLX
    • Anosmin-1
    • HHA
    • KAL
    • KAL1
    • KALIG 1
    • KALIG1
    • Kallmann syndrome 1 sequence
    • Kallmann syndrome 1 sequence (anosmin 1)
    • Kallmann syndrome interval gene 1
    • Kallmann syndrome protein
    • KALM
    • KALM_HUMAN
    • KMS
    • OTTHUMP00000022873
    see all
  • Function
    May be an adhesion-like molecule with anti-protease activity.
  • Involvement in disease
    Defects in KAL1 are the cause of Kallmann syndrome type 1 (KAL1) [MIM:308700]; also known as hypogonadotropic hypogonadism and anosmia. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin-releasing hormone-synthesizing neurons. In some patients other developmental anomalies can be present, which include renal agenesis, cleft lip and/or palate, selective tooth agenesis, and bimanual synkinesis. In some cases anosmia may be absent or inconspicuous.
  • Sequence similarities
    Contains 4 fibronectin type-III domains.
    Contains 1 WAP domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell surface.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116854 at approximately 37.73kDa and stained with Coomassie Blue.

References

ab116854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up