Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQVTWAEVTTESR QNSLPNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQVLTPGGEGPATI KTFRTPELPP
    • Molecular weight
      38 kDa including tags
    • Amino acids
      548 to 657

Specifications

Our Abpromise guarantee covers the use of ab116854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adhesion molecule-like X-linked
    • ADMLX
    • Anosmin-1
    • HHA
    • KAL
    • KAL1
    • KALIG 1
    • KALIG1
    • Kallmann syndrome 1 sequence
    • Kallmann syndrome 1 sequence (anosmin 1)
    • Kallmann syndrome interval gene 1
    • Kallmann syndrome protein
    • KALM
    • KALM_HUMAN
    • KMS
    • OTTHUMP00000022873
    see all
  • Function
    May be an adhesion-like molecule with anti-protease activity.
  • Involvement in disease
    Defects in KAL1 are the cause of Kallmann syndrome type 1 (KAL1) [MIM:308700]; also known as hypogonadotropic hypogonadism and anosmia. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin-releasing hormone-synthesizing neurons. In some patients other developmental anomalies can be present, which include renal agenesis, cleft lip and/or palate, selective tooth agenesis, and bimanual synkinesis. In some cases anosmia may be absent or inconspicuous.
  • Sequence similarities
    Contains 4 fibronectin type-III domains.
    Contains 1 WAP domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell surface.
  • Information by UniProt

Recombinant Human KAL1 protein images

  • 12.5% SDS-PAGE showing ab116854 at approximately 37.73kDa and stained with Coomassie Blue.

References for Recombinant Human KAL1 protein (ab116854)

ab116854 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up