Recombinant Human Kallikrein 12 protein (ab162332)

Overview

  • Product name
    Recombinant Human Kallikrein 12 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGLSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGV LIDHRWVLTAAHCSGRPIPGSAPVPQPLHRLPCHLPWCVSRENHEQHGVC RRRPGAGCLPG
    • Amino acids
      1 to 111
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162332 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686H1078
    • Kallikrein like protein 5
    • Kallikrein related peptidase 12
    • Kallikrein12
    • KLK 12
    • KLK L5
    • KLK12
    • KLKL5
    • MGC42603
    see all
  • Relevance
    The human tissue Kallikrein gene family encodes 15 serine proteases. All Kallikreins share structural similarities including cysteine residues, a catalytic triad of His, Asp, and Ser residues, typically five coding exons, and varied intron phases. Kallikreins are predominantly secreted as inactive zymogens prior to activation by cleavage of an N-terminal peptide, and all function extracellularly. Kallikreins can be activated autocatalytically, via other Kallikreins, or additional proteases. While structurally similar, Kallikrein family members have distinct functions and have key roles in many physiological and pathological processes. Many human tissue Kallikreins also show promise as cancer biomarkers, which may facilitate earlier detection and characterization of many forms of cancer. Kallikrein 12, also known as Kallikrein-like5 (KLK-L5), is a trypsin-like serine proteinase. It was discovered by cloning the kallikrein locus on chromosome 19, and was found to be similar to the other kallikrein family genes. It is produced by a number of tissues, including pancreas, salivary gland, breast, prostate, uterus, lung, thymus, thyroid, brain, stomach and colon. Kallikrein 12 message has been reported to be decreased in breast cancer. Different splice variants of kallikrein-12 have been identified; a 254 amino acid form, 248 amino acids form, and a truncated 111 amino acid form.
  • Cellular localization
    Secreted

Images

  • ab162332 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162332 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162332.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up