Recombinant Human Kallikrein 13 protein (ab132021)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MWPLALVIASLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQ AALLVQGRLLCGGVLVHPKWVLTAAHCLKEGLKVYLGKHALGRVEAGEQV REVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGYIQTLPLSHNNR LTPGTTCRVSGWGTTTSPQVNYPKTLQCANIQLRSDEECRQVYPGKITDN MLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTR VSRYVLWIRETIRKYETQQQKWLKGPQ
    • Molecular weight
      57 kDa including tags
    • Amino acids
      1 to 277

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp586J1923
    • Kalikrein
    • Kallikrein 13
    • Kallikrein L4
    • Kallikrein Like 4
    • Kallikrein like 4 variant included
    • Kallikrein like gene 4
    • Kallikrein like protein 4
    • Kallikrein related peptidase 13
    • Kallikrein-13
    • Kallikrein-like protein 4
    • KLK-L4
    • KLK13
    • KLK13_HUMAN
    • KLKL 4
    • KLKL4
    see all
  • Tissue specificity
    Expressed in prostate, breast, testis and salivary gland.
  • Sequence similarities
    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human Kallikrein 13 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132021 at approximately 57 kDa.

References for Recombinant Human Kallikrein 13 protein (ab132021)

ab132021 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab132021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up