Recombinant Human Kallikrein 13 protein (ab132021)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MWPLALVIASLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQ AALLVQGRLLCGGVLVHPKWVLTAAHCLKEGLKVYLGKHALGRVEAGEQV REVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGYIQTLPLSHNNR LTPGTTCRVSGWGTTTSPQVNYPKTLQCANIQLRSDEECRQVYPGKITDN MLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTR VSRYVLWIRETIRKYETQQQKWLKGPQ
    • Molecular weight
      57 kDa including tags
    • Amino acids
      1 to 277

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp586J1923
    • Kalikrein
    • Kallikrein 13
    • Kallikrein L4
    • Kallikrein Like 4
    • Kallikrein like 4 variant included
    • Kallikrein like gene 4
    • Kallikrein like protein 4
    • Kallikrein related peptidase 13
    • Kallikrein-13
    • Kallikrein-like protein 4
    • KLK-L4
    • KLK13
    • KLK13_HUMAN
    • KLKL 4
    • KLKL4
    see all
  • Tissue specificity
    Expressed in prostate, breast, testis and salivary gland.
  • Sequence similarities
    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132021 at approximately 57 kDa.

References

ab132021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up