Recombinant Human Kallikrein 13 protein (ab151668)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLLCGGVLV HPKWVLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSP THLNHDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTPGTTCRVSGWGTTT SPQVNYPKTLQCANIQLRSDEECRQVYPGKITDNMLCAGTKEGGKDSCEG DSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWIRETIVDHH HHHH
    • Molecular weight
      28 kDa including tags
    • Amino acids
      17 to 262
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151668 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 5.50
    Constituents: 0.39% MES, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • DKFZp586J1923
    • Kalikrein
    • Kallikrein 13
    • Kallikrein L4
    • Kallikrein Like 4
    • Kallikrein like 4 variant included
    • Kallikrein like gene 4
    • Kallikrein like protein 4
    • Kallikrein related peptidase 13
    • Kallikrein-13
    • Kallikrein-like protein 4
    • KLK-L4
    • KLK13
    • KLK13_HUMAN
    • KLKL 4
    • KLKL4
    see all
  • Tissue specificity
    Expressed in prostate, breast, testis and salivary gland.
  • Sequence similarities
    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab151668 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151668.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up