Recombinant Human Kallikrein 4 protein (ab153005)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGQDQKDSCNGDSG GPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQAS
    • Amino acids
      159 to 254
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153005 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 7S nerve growth factor alpha chain
    • AI2A1
    • Alpha-NGF
    • Androgen-regulated message 1
    • ARM1
    • EC 3.4.21.-
    • EMSP
    • EMSP 1
    • EMSP1
    • Enamel Matrix Serine Protease 1
    • Enamel matrix serine proteinase 1
    • HK4
    • Kallikrein
    • Kallikrein 1-related peptidase-like b4
    • Kallikrein 4
    • Kallikrein 4 (prostase, enamel matrix, prostate)
    • Kallikrein L1
    • Kallikrein like protein 1
    • Kallikrein related-peptidase 4 (prostase, enamel matrix, prostate)
    • Kallikrein-4
    • Kallikrein-like protein 1
    • Kallikrein-related peptidase 4
    • KLK 4
    • KLK L1
    • KLK-L1
    • KLK4
    • KLK4_HUMAN
    • MGC116827
    • MGC116828
    • Prostase
    • Protease Serine 17
    • PRSS 17
    • PRSS17
    • PSTS
    • Serine protease 17
    see all
  • Tissue specificity
    Expressed in prostate.
  • Involvement in disease
    Defects in KLK4 are the cause of amelogenesis imperfecta hypomaturation type 2A1 (AI2A1) [MIM:204700]. AI2A1 is an autosomal recessive defect of enamel formation. The disorder involves both primary and secondary dentitions. The teeth have a shiny agar jelly appearance and the enamel is softer than normal. Brown pigment is present in middle layers of enamel.
  • Sequence similarities
    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab153005 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153005 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153005.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up