Recombinant Human Kallikrein 7 protein (ab114437)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49862
    • SpeciesHuman
    • SequenceIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHL GSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKK
    • Molecular weight37 kDa including tags
    • Amino acids31 to 130

Specifications

Our Abpromise guarantee covers the use of ab114437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chymotryptic stratum corneum
    • hK 7
    • hK7
    • hSCCE
    • Kallikrein 7 (chymotryptic stratum corneum)
    • Kallikrein related peptidase 7
    • Kallikrein-7
    • Kallikrein7
    • KLK 7
    • Klk7
    • KLK7_HUMAN
    • Protease serine 6
    • PRSS 6
    • PRSS6
    • SCCE
    • Serine protease 6
    • Signal protein
    • Stratum corneum chymotryptic enzyme
    see all
  • FunctionMay catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. SCCE cleaves insulin B chain at '6-Leu-
    -Cys-7', '16-Tyr-
    -Leu-17', '25-Phe-
    -Tyr-26' and '26-Tyr-
    -Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.
  • Tissue specificityAbundantly expressed in the skin and is expressed by keratinocytes in the epidermis. Also expressed in the brain, mammary gland, cerebellum, spinal cord and kidney. Lower levels in salivary glands, uterus, thymus, thyroid, placenta, trachea and testis. Up-regulated in ovarian carcinoma, especially late-stage serous carcinoma, compared with normal ovaries and benign adenomas (at protein level).
  • Sequence similaritiesBelongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localizationSecreted. In ovarian carcinoma, secreted and also observed at the apical membrane and in cytoplasm at the invasive front.
  • Information by UniProt

Recombinant Human Kallikrein 7 protein images

  • ab114437 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Kallikrein 7 protein (ab114437)

ab114437 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"