Recombinant human Kallikrein 7 protein (ab191666)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCK MNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQA RLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLIS PQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWG TFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
    • Molecular weight
      26 kDa including tags
    • Amino acids
      23 to 253
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Mature protein with Propeptide. Without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab191666 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to cleave the fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK (Dnp) NH2. The specific activity is >130 pmoles / min / μg.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.87% Sodium chloride, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Size: 1 mg It is recommended to reconstitute the lyophilized product in 1000 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.18/01/2013 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

General Info

  • Alternative names
    • Chymotryptic stratum corneum
    • hK 7
    • hK7
    • hSCCE
    • Kallikrein 7 (chymotryptic stratum corneum)
    • Kallikrein related peptidase 7
    • Kallikrein-7
    • Kallikrein7
    • KLK 7
    • Klk7
    • KLK7_HUMAN
    • Protease serine 6
    • PRSS 6
    • PRSS6
    • SCCE
    • Serine protease 6
    • Signal protein
    • Stratum corneum chymotryptic enzyme
    see all
  • Function
    May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. SCCE cleaves insulin B chain at '6-Leu-
    -Cys-7', '16-Tyr-
    -Leu-17', '25-Phe-
    -Tyr-26' and '26-Tyr-
    -Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.
  • Tissue specificity
    Abundantly expressed in the skin and is expressed by keratinocytes in the epidermis. Also expressed in the brain, mammary gland, cerebellum, spinal cord and kidney. Lower levels in salivary glands, uterus, thymus, thyroid, placenta, trachea and testis. Up-regulated in ovarian carcinoma, especially late-stage serous carcinoma, compared with normal ovaries and benign adenomas (at protein level).
  • Sequence similarities
    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted. In ovarian carcinoma, secreted and also observed at the apical membrane and in cytoplasm at the invasive front.
  • Information by UniProt

Images

  • The purity of Kallikrein 7 was determined by DTT- reduced (+) SDS-PAGE and staining overnight with Coomassie Blue. Protein migrates as 29-33 kDa in SDS-PAGE due to glycosylation.

References

ab191666 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191666.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up