Recombinant Human Kallikrein 7/KLK7 protein (denatured) (ab134589)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Kallikrein 7/KLK7 protein (denatured)
See all Kallikrein 7/KLK7 proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMIIDGAPCARGSHPWQVALLSGNQLH CGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGY STQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTS PDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGD SGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR -
Predicted molecular weight
27 kDa including tags -
Amino acids
30 to 253 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab134589 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Additional notes
This product was previously labelled as Kallikrein 7
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 12.01% Urea, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- Chymotryptic stratum corneum
- hK 7
- hK7
see all -
Function
May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. SCCE cleaves insulin B chain at '6-Leu-
-Cys-7', '16-Tyr-
-Leu-17', '25-Phe-
-Tyr-26' and '26-Tyr-
-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines. -
Tissue specificity
Abundantly expressed in the skin and is expressed by keratinocytes in the epidermis. Also expressed in the brain, mammary gland, cerebellum, spinal cord and kidney. Lower levels in salivary glands, uterus, thymus, thyroid, placenta, trachea and testis. Up-regulated in ovarian carcinoma, especially late-stage serous carcinoma, compared with normal ovaries and benign adenomas (at protein level). -
Sequence similarities
Belongs to the peptidase S1 family. Kallikrein subfamily.
Contains 1 peptidase S1 domain. -
Cellular localization
Secreted. In ovarian carcinoma, secreted and also observed at the apical membrane and in cytoplasm at the invasive front. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab134589 has not yet been referenced specifically in any publications.