Recombinant Human Kallistatin protein (ab116855)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLK IAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQ ILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLK FLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSE LKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQ EHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMR WNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSG ITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFN RPFLVVIFSTSTQSVLFLGKVVDPTKP
    • Molecular weight
      73 kDa including tags
    • Amino acids
      1 to 427

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KAIN_HUMAN
    • KAL
    • Kallikrein binding protein
    • Kallikrein inhibitor
    • Kallistatin
    • KBP
    • KLST
    • KST
    • MGC108582
    • Peptidase inhibitor 4
    • PI-4
    • PI4
    • Protease inhibitor 4
    • Protease inhibitor 4 (kallistatin)
    • Serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 4
    • Serpin A4
    • Serpin peptidase inhibitor clade A member 4
    • Serpin peptidase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 4
    • SERPINA4
    • Tissue kallistatin inhibitor
    see all
  • Function
    Inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibitor due to cleavage at the reactive site by tissue kallikrein.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Sequence similarities
    Belongs to the serpin family.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116855 at approximately 73.04kDa and stained with Coomassie Blue.

References

ab116855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us. Here is a protocol that can be applied with this protein (ab116855) to perform an ELISA: 1. Coat antigen (200ng/well) onto the wells in a 96 well mictrotiter plate 2. Block unbound sites with 5% skim milk in PBST 3. A...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up