Recombinant Human Kallistatin protein (ab116855)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLK IAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQ ILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLK FLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSE LKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQ EHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMR WNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSG ITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFN RPFLVVIFSTSTQSVLFLGKVVDPTKP
    • Molecular weight
      73 kDa including tags
    • Amino acids
      1 to 427

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KAIN_HUMAN
    • KAL
    • Kallikrein binding protein
    • Kallikrein inhibitor
    • Kallistatin
    • KBP
    • KLST
    • KST
    • MGC108582
    • Peptidase inhibitor 4
    • PI-4
    • PI4
    • Protease inhibitor 4
    • Protease inhibitor 4 (kallistatin)
    • Serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 4
    • Serpin A4
    • Serpin peptidase inhibitor clade A member 4
    • Serpin peptidase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 4
    • SERPINA4
    • Tissue kallistatin inhibitor
    see all
  • Function
    Inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibitor due to cleavage at the reactive site by tissue kallikrein.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Sequence similarities
    Belongs to the serpin family.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human Kallistatin protein images

  • 12.5% SDS-PAGE showing ab116855 at approximately 73.04kDa and stained with Coomassie Blue.

References for Recombinant Human Kallistatin protein (ab116855)

ab116855 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. Here is a protocol that can be applied with this protein (ab116855) to perform an ELISA: 1. Coat antigen (200ng/well) onto the wells in a 96 well mictrotiter plate 2. Block unbound sites with 5% skim milk in PBST 3. A...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up