Recombinant Human Kappa Opioid Receptor protein (ab114296)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLE PAHISPAI
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 58

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • K-OR-1
    • Kappa opioid receptor
    • Kappa type opioid receptor
    • Kappa-type opioid receptor
    • KOR
    • KOR 1
    • KOR-1
    • Opiate receptor kappa 1
    • Opiate receptor, kappa 1
    • Opioid receptor, kappa 1
    • OPRK
    • OPRK 1
    • OPRK_HUMAN
    • OPRK1
    • Oprk2
    • R21
    see all
  • Function
    Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Receptor for dynorphins. May play a role in arousal and regulation of autonomic and neuroendocrine functions.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human Kappa Opioid Receptor protein images

  • 12.5% SDS-PAGE image showing ab114296 at approx 32.01 kDa. Stained with Coomassie Blue.

References for Recombinant Human Kappa Opioid Receptor protein (ab114296)

ab114296 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up