Recombinant Human Karyopherin beta 3 protein (ab114896)

Overview

  • Product name
    Recombinant Human Karyopherin beta 3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIR NTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQME
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 100

Specifications

Our Abpromise guarantee covers the use of ab114896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686O1576
    • FLJ43041
    • IMB3
    • Imp5
    • Importin 5
    • Importin beta 3 subunit
    • Importin subunit beta 3
    • Importin subunit beta-3
    • Importin-5
    • IPO 5
    • IPO5
    • IPO5_HUMAN
    • Karyopherin beta 3
    • Karyopherin beta-3
    • KPNB3
    • MGC2068
    • Pse1
    • Ran binding protein 5
    • Ran GTP binding protein 5
    • Ran-binding protein 5
    • RanBP 5
    • RanBP5
    see all
  • Function
    Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev.
  • Sequence similarities
    Belongs to the importin beta family.
    Contains 6 HEAT repeats.
    Contains 1 importin N-terminal domain.
  • Cellular localization
    Cytoplasm. Nucleus. Nucleus > nucleolus. Nucleus; nuclear rim. Found particularly in the nuclear rim and nucleolus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114896 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References

ab114896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up