Recombinant Human KAT1 / HAT1 protein (ab116481)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO14929
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMKKLAEYKCNTNTAIELKLVRFPEDLENDI RTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDEN FDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSV LSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDER WHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQ GQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLP CFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTD
    • Molecular weight40 kDa including tags
    • Amino acids20 to 341
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab116481 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional notesalthough stable at 4°C for 30 days, should be stored desiccated below -20°C for periods greater than 30 days. Please avoid freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol

General Info

  • Alternative names
    • HAT 1
    • hat1
    • HAT1_HUMAN
    • Histidine aminotransferase 1
    • Histone acetyltransferase 1
    • Histone acetyltransferase type B catalytic subunit
    • KAT1
    see all
  • FunctionAcetylates soluble but not nucleosomal histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, acetylates histone H2A at 'Lys-5' (H2AK5ac). Has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. May be involved in nucleosome assembly during DNA replication and repair as part of the histone H3.1 and H3.3 complexes. May play a role in DNA repair in response to free radical damage.
  • Sequence similaritiesBelongs to the HAT1 family.
  • Developmental stageHighly expressed in mitotic cells (at protein level).
  • Cellular localizationNucleus matrix and Cytoplasm. Nucleus. Nucleus matrix. Nucleus > nucleoplasm. Localization is predominantly nuclear in normal cells. Treatment with hydrogen peroxide or ionizing radiation enhances nuclear localization through redistribution of existing protein.
  • Information by UniProt

References for Recombinant Human KAT1 / HAT1 protein (ab116481)

ab116481 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"