Recombinant Human KAT2A / GCN5 protein (ab111648)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ92830
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGGGSNSSLSLDSAGAEPMPGEKRTLPENL TLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETA RLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGY GTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLG YIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVY PGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNL LAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTR KLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
    • Molecular weight51 kDa including tags
    • Amino acids411 to 837
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab111648 is purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.08% DTT, 40% Glycerol, 1.17% Sodium chloride, 0.03% EDTA, 0.32% Tris HCl

General Info

  • Alternative names
    • 1110051E14Rik
    • AW212720
    • EC 2.3.1.48
    • GCN 5
    • Gcn5
    • GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2
    • GCN5 general control of amino-acid synthesis 5-like 2 (yeast)
    • GCN5L2
    • general control of amino acid synthesis 5-like 2
    • General control of amino acid synthesis protein 5-like 2
    • General control of amino acid synthesis, yeast, homolog-like 2
    • HGCN5
    • Histone acetyltransferase GCN5
    • Histone acetyltransferase KAT2A
    • hsGCN5
    • K(lysine) acetyltransferase 2A
    • KAT2 A
    • KAT2A
    • KAT2A_HUMAN
    • Lysine acetyltransferase 2A
    • MGC102791
    • PCAF-b
    • STAF97
    see all
  • FunctionFunctions as a histone acetyltransferase (HAT) to promote transcriptional activation. Acetylation of histones gives a specific tag for epigenetic transcription activation. Has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles. In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
  • Tissue specificityExpressed in all tissues tested, with most abundant expression in ovary.
  • Sequence similaritiesBelongs to the GCN5 family.
    Contains 1 bromo domain.
    Contains 1 N-acetyltransferase domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human KAT2A / GCN5 protein images

  • 15% SDS-PAGE analysis of ab111648 (3 µg)

References for Recombinant Human KAT2A / GCN5 protein (ab111648)

ab111648 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111648.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"