Recombinant Human KAT6B / MORF protein (ab161671)

Overview

  • Product name
    Recombinant Human KAT6B / MORF protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEEPNGSSLKNI EKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQY
    • Amino acids
      80 to 172
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161671 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp313G1618
    • FLJ90335
    • Histone acetyltransferase MORF
    • Histone acetyltransferase MOZ2
    • Histone acetyltransferase MYST4
    • KAT 6B
    • KIAA0383
    • Monocytic leukemia zinc finger protein related factor
    • Monocytic leukemia zinc finger protein-related factor
    • MOZ
    • MOZ 2
    • MOZ related factor
    • MOZ YBF2/SAS3 SAS2 and TIP60 protein 4
    • MOZ2
    • MYST 4
    • MYST histone acetyltransferase (monocytic leukemia) 4
    • MYST protein 4
    • MYST-4
    • MYST4
    • MYST4_HUMAN
    • OTTHUMP00000019866
    • OTTHUMP00000019867
    • OTTHUMP00000019869
    • OTTHUMP00000019870
    • QKF
    • Querkopf
    • SAS2 and TIP60 protein 4
    • YBF2/SAS3
    see all
  • Function
    Histone acetyltransferase which may be involved in both positive and negative regulation of transcription. Required for RUNX2-dependent transcriptional activation. May be involved in cerebral cortex development. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity.
  • Tissue specificity
    Ubiquitously expressed, with high levels in heart, pancreas, testis and ovary.
  • Involvement in disease
    Note=A chromosomal aberration involving MYST4 may be a cause acute myeloid leukemias. Translocation t(10;16)(q22;p13) with CREBBP.
  • Sequence similarities
    Belongs to the MYST (SAS/MOZ) family.
    Contains 1 C2HC-type zinc finger.
    Contains 1 H15 (linker histone H1/H5 globular) domain.
    Contains 2 PHD-type zinc fingers.
  • Domain
    The N-terminus is involved in transcriptional activation while the C-terminus is involved in transcriptional repression.
  • Post-translational
    modifications
    Autoacetylated.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161671 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161671 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161671.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up