Recombinant Human KAT7 / Hbo1 / MYST2 protein (ab161319)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQA LQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
    • Amino acids
      512 to 611
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Hbo 1
    • HBO1
    • HBOa
    • Histone acetyltransferase binding to hORC1
    • Histone acetyltransferase binding to ORC1
    • Histone acetyltransferase KAT7
    • Histone acetyltransferase MYST2
    • K(lysine) acetyltransferase 7
    • KAT 7
    • KAT7
    • Lysine acetyltransferase 7
    • MOZ
    • MOZ YBF2/SAS3 SAS2 and TIP60 protein
    • MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2
    • MYST 2
    • MYST histone acetyltransferase 2
    • MYST protein 2
    • MYST-2
    • MYST2
    • MYST2_HUMAN
    • SAS 2
    • SAS2 and TIP60 protein 2
    • TIP60 protein 2
    • YBF2/SAS3
    • ZC2HC7
    see all
  • Function
    Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Through chromatin acetylation it may regulate DNA replication and act as a coactivator of TP53-dependent transcription. Specifically represses AR-mediated transcription.
  • Tissue specificity
    Ubiquitously expressed, with highest levels in testis.
  • Sequence similarities
    Belongs to the MYST (SAS/MOZ) family.
    Contains 1 C2HC-type zinc finger.
  • Domain
    The C2HC-type zinc finger is required for interaction with MCM2 and ORC1L.
    The N-terminus is involved in transcriptional repression, while the C-terminus mediates AR-interaction.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus > nucleoplasm.
  • Information by UniProt

Images

  • ab161319 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161319 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161319.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up