Recombinant Human KAT8 / MYST1 / MOF protein (ab153548)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGE PEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRL DEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEIN HVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPED YGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYE VDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPE KPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTL QSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITGGWGAAVCRGRWG SVSMWTGRSQGLLIAVT
    • Amino acids
      1 to 467
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153548 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Histone acetyltransferase KAT8
    • Histone acetyltransferase MYST1
    • hMOF
    • K(lysine) acetyltransferase 8
    • KAT 8
    • Lysine acetyltransferase 8
    • MOF
    • MOZ
    • MOZ, YBF2/SAS3, SAS2 and TIP60 protein 1
    • MYST 1
    • MYST histone acetyltransferase 1
    • myst protein 1
    • MYST-1
    • MYST1
    • MYST1_HUMAN
    • Ortholog of Drosophila males absent on the first (MOF)
    • Probable histone acetyltransferase MYST1
    • SAS2
    • SAS2 and TIP60 protein 1
    • SAS3
    • TIP60 protein 1
    • YBF2
    • YBF2/SAS3
    • ZC2HC8
    see all
  • Function
    Histone acetyltransferase which may be involved in transcriptional activation. May influence the function of ATM.
  • Sequence similarities
    Belongs to the MYST (SAS/MOZ) family.
    Contains 1 C2HC-type zinc finger.
    Contains 1 chromo domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153548 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153548 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153548.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up