Recombinant Human KAT9 / Elp3 protein (ab153393)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYG LSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCP HISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRH RIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNN IYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSV YEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQ FTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVA RILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRD VRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGL LRLRKCSEETFRFELGGGVSIVRELHVYGSVVPVSSRDPTKFQHQGFGML LMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKMLK
    • Amino acids
      1 to 547
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp761L098
    • Elongation protein 3 homolog
    • Elongation protein 3 homolog (S. cerevisiae)
    • ELONGATION PROTEIN 3, S. CEREVISIAE, HOMOLOG OF
    • elongator acetyltransferase complex subunit 3
    • Elongator complex protein 3
    • elp3
    • ELP3_HUMAN
    • FLJ10422
    • hELP3
    • Hypothetical protein DKFZp761L098
    • Kat9
    see all
  • Function
    Catalytic histone acetyltransferase subunit of the RNA polymerase II elongator complex, which is a component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4. May also have a methyltransferase activity.
  • Sequence similarities
    Belongs to the ELP3 family.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab153393 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153393 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153393.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up