Overview

  • Product name
    Recombinant Human KCNA3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLS KSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
    • Molecular weight
      37 kDa including tags
    • Amino acids
      476 to 575

Specifications

Our Abpromise guarantee covers the use of ab114518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HGK 5
    • HGK5
    • HLK 3
    • HLK3
    • HPCN 3
    • HPCN3
    • HuKIII
    • KCNA 3
    • Kcna3
    • KCNA3_HUMAN
    • KV1.3
    • MK 3
    • MK3
    • OTTHUMP00000032397
    • PCN 3
    • PCN3
    • Potassium channel 3
    • Potassium voltage gated channel shaker related subfamily member 3
    • Potassium voltage gated channel subfamily A member 3
    • Potassium voltage-gated channel subfamily A member 3
    • Type n potassium channel
    • Voltage gated potassium channel protein Kv1.3
    • Voltage gated potassium channel subunit Kv1.3
    • Voltage-gated K(+) channel HuKIII
    • Voltage-gated potassium channel subunit Kv1.3
    see all
  • Function
    Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
  • Sequence similarities
    Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.3/KCNA3 sub-subfamily.
  • Domain
    The N-terminus may be important in determining the rate of inactivation of the channel while the tail may play a role in modulation of channel activity and/or targeting of the channel to specific subcellular compartments.
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human KCNA3 protein images

  • ab114518 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human KCNA3 protein (ab114518)

ab114518 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up