Overview

  • Product name
    Recombinant Human KCNC3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGS IRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
    • Amino acids
      671 to 757
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Kcnc3
    • KCNC3_HUMAN
    • KSHIIID
    • KV3.3
    • Potassium voltage gated channel Shaw related subfamily member 3
    • Potassium voltage gated channel subfamily C member 3
    • Potassium voltage-gated channel subfamily C member 3
    • SCA13
    • Shaw related subfamily, member 3
    • Shaw related voltage gated potassium channel protein 3
    • Spinocerebellar ataxia 13
    • Voltage gated potassium channel protein KV3.3
    • Voltage gated potassium channel subunit Kv3.3
    • Voltage-gated potassium channel subunit Kv3.3
    see all
  • Function
    This protein mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
  • Involvement in disease
    Defects in KCNC3 are the cause of spinocerebellar ataxia type 13 (SCA13) [MIM:605259]. Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA13 is an autosomal dominant cerebellar ataxia (ADCA) characterized by slow progression and variable age at onset, ranging from childhood to late adulthood. Mental retardation can be present in some patients.
  • Sequence similarities
    Belongs to the potassium channel family. C (Shaw) (TC 1.A.1.2) subfamily. Kv3.3/KCNC3 sub-subfamily.
  • Domain
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
    The tail may be important in modulation of channel activity and/or targeting of the channel to specific subcellular compartments.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158780 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up