Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMS P
    • Amino acids
      73 to 123
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATFB4
    • cardiac voltage gated potassium channel accessory subunit 2
    • Kcne2
    • KCNE2_HUMAN
    • LQT5
    • LQT6
    • minimum potassium ion channel related peptide 1
    • Minimum potassium ion channel-related peptide 1
    • minK related peptide 1
    • MinK-related peptide 1
    • MIRP1
    • Potassium channel subunit beta MiRP1
    • potassium channel subunit, MiRP1
    • potassium voltage gated channel subfamily E member 2
    • potassium voltage gated channel, Isk related family, member 2
    • Potassium voltage-gated channel subfamily E member 2
    • voltage-gated K+ channel subunit MIRP1
    see all
  • Function
    Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with KCNQ1/KVLTQ1 and elicit a voltage-independent current. May associate with HCN1 and HCN2 and increase potassium current.
  • Tissue specificity
    Highly expressed in brain, heart, skeletal muscle, pancreas, placenta, kidney, colon and thymus. A small but significant expression is found in liver, ovary, testis, prostate, small intestine and leukocytes. Very low expression, nearly undetectable, in lung and spleen.
  • Involvement in disease
    Defects in KCNE2 are the cause of long QT syndrome type 6 (LQT6) [MIM:613693]. Long QT syndromes are heart disorders characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to exercise or emotional stress. KCNE2 mutants form channels that open slowly and close rapidly, thereby diminishing potassium currents.
    Defects in KCNE2 are the cause of atrial fibrillation familial type 4 (ATFB4) [MIM:611493]. Atrial fibrillation is a common disorder of cardiac rhythm that is hereditary in a small subgroup of patients. It is characterized by disorganized atrial electrical activity and ineffective atrial contraction promoting blood stasis in the atria and reduces ventricular filling. It can result in palpitations, syncope, thromboembolic stroke, and congestive heart failure.
  • Sequence similarities
    Belongs to the potassium channel KCNE family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160752 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160752 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up