Overview

  • Product name
    Recombinant Human KCNH1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKA LNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPESERDIFGA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      890 to 988

Specifications

Our Abpromise guarantee covers the use of ab116850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EAG
    • EAG channel 1
    • EAG1
    • Ether a go go potassium channel 1
    • Ether a go go, Drosophila, homolog of
    • Ether-a-go-go potassium channel 1
    • ether-a-go-go, Drosophila, homolog of
    • h eag
    • h-eag
    • hEAG1
    • Kcnh1
    • KCNH1_HUMAN
    • Kv10.1
    • M eag
    • MGC124419
    • MGC124420
    • MGC142269
    • Potassium voltage gated channel subfamily H (eag related), member 1
    • Potassium voltage gated channel subfamily H member 1
    • Potassium voltage-gated channel subfamily H member 1
    • Voltage gated potassium channel subunit Kv10.1
    • Voltage-gated potassium channel subunit Kv10.1
    see all
  • Function
    Pore-forming (alpha) subunit of voltage-gated non-inactivating delayed rectifier potassium channel. Channel properties may be modulated by cAMP and subunit assembly. Mediates IK(NI) current in myoblasts.
  • Tissue specificity
    Highly expressed in brain and in myoblasts at the onset of fusion, but not in other tissues. Detected in HeLa (cervical carcinoma), SH-SY5Y (neuroblastoma) and MCF-7 (epithelial tumor) cells, but not in normal epithelial cells.
  • Sequence similarities
    Belongs to the potassium channel family. H (Eag) (TC 1.A.1.20) subfamily. Kv10.1/KCNH1 sub-subfamily.
    Contains 1 cyclic nucleotide-binding domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 1 PAS (PER-ARNT-SIM) domain.
  • Domain
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human KCNH1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116850 at approximately 36.52 kDa.

References for Recombinant Human KCNH1 protein (ab116850)

ab116850 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up