Overview

  • Product name
    Recombinant Human KCNH2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LGMGWGAGTGLEMPSAASRGASLLNMQSLGLWTWDCLQGHWAPLIHLNSG PPSGAMERSPTWGEAAELWGSHILLPFRIRHKQTLFASLK
    • Molecular weight
      36 kDa including tags

Specifications

Our Abpromise guarantee covers the use of ab152488 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • eag homolog
    • Eag-related protein 1
    • ERG
    • ERG-1
    • ERG1
    • Ether a go go related potassium channel protein
    • Ether-a-go-go-related gene potassium channel 1
    • Ether-a-go-go-related protein 1
    • H ERG
    • H-ERG
    • HERG
    • HERG 1
    • hERG-1
    • hERG1
    • KCNH2
    • KCNH2_HUMAN
    • Kv11.1
    • LQT 2
    • LQT2
    • Potassium channel HERG
    • Potassium voltage gated channel subfamily H (eag related) member 2
    • Potassium voltage-gated channel subfamily H member 2
    • SQT1
    • Voltage gated potassium channel, subfamily H, member 2
    • Voltage-gated potassium channel subunit Kv11.1
    see all
  • Function
    Pore-forming (alpha) subunit of voltage-gated inwardly rectifying potassium channel. Channel properties are modulated by cAMP and subunit assembly. Mediates the rapidly activating component of the delayed rectifying potassium current in heart (IKr). Isoform 3 has no channel activity by itself, but modulates channel characteristics when associated with isoform 1.
  • Tissue specificity
    Highly expressed in heart and brain.
  • Involvement in disease
    Defects in KCNH2 are the cause of long QT syndrome type 2 (LQT2) [MIM:613688]. Long QT syndromes are heart disorders characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to exercise or emotional stress. Deafness is often associated with LQT2.
    Defects in KCNH2 are the cause of short QT syndrome type 1 (SQT1) [MIM:609620]. Short QT syndromes are heart disorders characterized by idiopathic persistently and uniformly short QT interval on ECG in the absence of structural heart disease in affected individuals. They cause syncope and sudden death.
  • Sequence similarities
    Belongs to the potassium channel family. H (Eag) (TC 1.A.1.20) subfamily. Kv11.1/KCNH2 sub-subfamily.
    Contains 1 cyclic nucleotide-binding domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 1 PAS (PER-ARNT-SIM) domain.
  • Domain
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Post-translational
    modifications
    Phosphorylated on serine and threonine residues. Phosphorylation by PKA inhibits ion conduction.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152488 stained with Coomassie Blue.

References

ab152488 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152488.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up