Overview

  • Product name
    Recombinant Human KCNH7 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VTDNENAATPERVNPILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPD VVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVN
    • Amino acids
      132 to 230
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 9330137I11Rik
    • eag related protein 3
    • ERG3
    • Ether a go go related gene potassium channel 3
    • HERG3
    • Kv11.3
    • Potassium channel subunit HERG 3
    • Potassium voltage channel subfamily H (eag-related) member 7
    • RP23-34J8.1
    see all
  • Relevance
    Pore-forming (alpha) subunit of voltage-gated potassium channel. Channel properties may be modulated by cAMP and subunit assembly.
  • Cellular localization
    Membrane; Multi-pass membrane protein

Images

  • ab164809 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up